PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca29495.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 306aa    MW: 34647.3 Da    PI: 5.7498
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca29495.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.32.1e-51131371128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeelv++yL++++++ ++++  +i+e+d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   + 
  Dca29495.1  13 LPPGFRFHPTDEELVMHYLCRRCASLSISV-PIIAEIDLYKFDPWDLPEKALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGK--PKP 108
                 79****************************.88***************8777889*************************************98..789 PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 v +kk Lvfy g+apkgekt+W+mheyrl
  Dca29495.1 109 VAIKKALVFYAGKAPKGEKTNWIMHEYRL 137
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-619168IPR003441NAC domain
PROSITE profilePS5100558.913168IPR003441NAC domain
PfamPF023652.8E-2614137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGVVGGGSDE LELPPGFRFH PTDEELVMHY LCRRCASLSI SVPIIAEIDL YKFDPWDLPE  60
KALYGEKEWY FFSPRDRKYP NGSRPNRAAG TGYWKATGAD KPIGKPKPVA IKKALVFYAG  120
KAPKGEKTNW IMHEYRLADV DRSASSRKTN NNNSLRLDDW VLCRIYNKKG CIEKQNGSVV  180
KQETTQLNQG YDIDHDPDFN LVDNKTEVLP PSFSEYMLME SPSDSMPPPP PSTTSCSEQV  240
VSPVDLPCER EVQSEPKSKW KTTGVEKALE FPLSYMDMSM ENAFSVHGGN QMSPLQDMFL  300
FLQRPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-811017412174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015575373.11e-132PREDICTED: NAC domain-containing protein 2
SwissprotQ390131e-123NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB9S2X21e-132B9S2X2_RICCO; NAC domain-containing protein, putative
STRINGVIT_18s0001g02300.t011e-129(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-118NAC family protein